FIGN monoclonal antibody (M02), clone 2F8 View larger

FIGN monoclonal antibody (M02), clone 2F8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FIGN monoclonal antibody (M02), clone 2F8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about FIGN monoclonal antibody (M02), clone 2F8

Brand: Abnova
Reference: H00055137-M02
Product name: FIGN monoclonal antibody (M02), clone 2F8
Product description: Mouse monoclonal antibody raised against a partial recombinant FIGN.
Clone: 2F8
Isotype: IgG2a Kappa
Gene id: 55137
Gene name: FIGN
Gene alias: -
Gene description: fidgetin
Genbank accession: NM_018086
Immunogen: FIGN (NP_060556.2, 77 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GILEGPVDRPVLSNYSDTPSGLVNGRKNESEPWQPSLNSEAVYPMNCVPDVITASKAGVSSALPPADVSASIGSSPGVASNLTEPSYSSSTCGS
Protein accession: NP_060556.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055137-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.08 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055137-M02-1-1-1.jpg
Application image note: FIGN monoclonal antibody (M02), clone 2F8. Western Blot analysis of FIGN expression in HeLa.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FIGN monoclonal antibody (M02), clone 2F8 now

Add to cart