Brand: | Abnova |
Reference: | H00055137-M02 |
Product name: | FIGN monoclonal antibody (M02), clone 2F8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FIGN. |
Clone: | 2F8 |
Isotype: | IgG2a Kappa |
Gene id: | 55137 |
Gene name: | FIGN |
Gene alias: | - |
Gene description: | fidgetin |
Genbank accession: | NM_018086 |
Immunogen: | FIGN (NP_060556.2, 77 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GILEGPVDRPVLSNYSDTPSGLVNGRKNESEPWQPSLNSEAVYPMNCVPDVITASKAGVSSALPPADVSASIGSSPGVASNLTEPSYSSSTCGS |
Protein accession: | NP_060556.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.08 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | FIGN monoclonal antibody (M02), clone 2F8. Western Blot analysis of FIGN expression in HeLa. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |