Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of WDR79 monoclonal antibody (M04), clone 1F12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about WDR79 monoclonal antibody (M04), clone 1F12
| Brand: | Abnova |
| Reference: | H00055135-M04 |
| Product name: | WDR79 monoclonal antibody (M04), clone 1F12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant WDR79. |
| Clone: | 1F12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 55135 |
| Gene name: | WDR79 |
| Gene alias: | FLJ10385|WRAP53 |
| Gene description: | WD repeat domain 79 |
| Genbank accession: | NM_018081 |
| Immunogen: | WDR79 (NP_060551.1, 62 a.a. ~ 160 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AVSQELREGDPVSLSTPLETEFGSPSELSPRIEEQELSENTSLPAEEANGSLSEEEANGPELGSGKAMEDTSGEPAAEDEGDTAWNYSFSQLPRFLSGS |
| Protein accession: | NP_060551.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | WDR79 monoclonal antibody (M04), clone 1F12. Western Blot analysis of WDR79 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Neuronal accumulation of unrepaired DNA in a novel specific chromatin domain: structural, molecular and transcriptional characterization.Mata-Garrido J, Casafont I, Tapia O, Berciano MT, Lafarga M. Acta Neuropathol Commun. 2016 Apr 22;4(1):41. |