ARMC4 monoclonal antibody (M02), clone 5F1 View larger

ARMC4 monoclonal antibody (M02), clone 5F1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARMC4 monoclonal antibody (M02), clone 5F1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ARMC4 monoclonal antibody (M02), clone 5F1

Brand: Abnova
Reference: H00055130-M02
Product name: ARMC4 monoclonal antibody (M02), clone 5F1
Product description: Mouse monoclonal antibody raised against a partial recombinant ARMC4.
Clone: 5F1
Isotype: IgG1 Kappa
Gene id: 55130
Gene name: ARMC4
Gene alias: DKFZp434P1735|FLJ10376|FLJ10817|FLJ32798|RP11-691I13.1
Gene description: armadillo repeat containing 4
Genbank accession: NM_018076
Immunogen: ARMC4 (NP_060546, 945 a.a. ~ 1044 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHENGAVKLLLDMVGSPDQDLQEAAAGCISNIRRLALATEKARYT
Protein accession: NP_060546
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055130-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055130-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged ARMC4 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ARMC4 monoclonal antibody (M02), clone 5F1 now

Add to cart