Brand: | Abnova |
Reference: | H00055130-M02 |
Product name: | ARMC4 monoclonal antibody (M02), clone 5F1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ARMC4. |
Clone: | 5F1 |
Isotype: | IgG1 Kappa |
Gene id: | 55130 |
Gene name: | ARMC4 |
Gene alias: | DKFZp434P1735|FLJ10376|FLJ10817|FLJ32798|RP11-691I13.1 |
Gene description: | armadillo repeat containing 4 |
Genbank accession: | NM_018076 |
Immunogen: | ARMC4 (NP_060546, 945 a.a. ~ 1044 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHENGAVKLLLDMVGSPDQDLQEAAAGCISNIRRLALATEKARYT |
Protein accession: | NP_060546 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ARMC4 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |