Cart 8 Product Products 2 021,62 € (empty)
No products
To be determined Shipping
2 021,62 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 8 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 021,62 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 021,62 €
Data sheet of C6orf166 monoclonal antibody (M01), clone 3D9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about C6orf166 monoclonal antibody (M01), clone 3D9
| Brand: | Abnova |
| Reference: | H00055122-M01 |
| Product name: | C6orf166 monoclonal antibody (M01), clone 3D9 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant C6orf166. |
| Clone: | 3D9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 55122 |
| Gene name: | AKIRIN2 |
| Gene alias: | C6orf166|FBI1|FLJ10342|dJ486L4.2 |
| Gene description: | akirin 2 |
| Genbank accession: | BC000764 |
| Immunogen: | C6orf166 (AAH00764, 1 a.a. ~ 203 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPTSAAASPLSAAAATAASFSAAAASPQKYLRMEPSPFGDVSSRLTTEQILYNIKQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQPLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS |
| Protein accession: | AAH00764 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (48.07 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to AKIRIN2 on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |