Cart 23 Product Products 8 847,69 € (empty)
No products
To be determined Shipping
8 847,69 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 23 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 8 847,69 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 8 847,69 €
Data sheet of PLEKHJ1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
More info about PLEKHJ1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00055111-B01P |
| Product name: | PLEKHJ1 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human PLEKHJ1 protein. |
| Gene id: | 55111 |
| Gene name: | PLEKHJ1 |
| Gene alias: | FLJ10297|GNRPX |
| Gene description: | pleckstrin homology domain containing, family J member 1 |
| Genbank accession: | NM_018049.1 |
| Immunogen: | PLEKHJ1 (NP_060519.1, 1 a.a. ~ 149 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MRYNEKELQALSRQPAEMAAELGMRGPKKGSVLKRRLVKLVVNFLFYFRTDEAEPVGALLLERCRVVREEPGTFSISFIEDPERKYHFECSSEEQCQEWMEALRRASYEFMRRSLIFYRNEIRKVTGKDPLEQFGISEEARFQLSGLQA |
| Protein accession: | NP_060519.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PLEKHJ1 expression in transfected 293T cell line (H00055111-T01) by PLEKHJ1 MaxPab polyclonal antibody. Lane 1: PLEKHJ1 transfected lysate(16.39 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |