Cart 26 Product Products 10 335,59 € (empty)
No products
To be determined Shipping
10 335,59 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 26 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 10 335,59 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 10 335,59 €
Data sheet of FLJ10292 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,WB-Tr |
More info about FLJ10292 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00055110-B01P |
| Product name: | FLJ10292 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human FLJ10292 protein. |
| Gene id: | 55110 |
| Gene name: | MAGOHB |
| Gene alias: | FLJ10292|MGN2|mago|magoh |
| Gene description: | mago-nashi homolog B (Drosophila) |
| Genbank accession: | NM_018048 |
| Immunogen: | FLJ10292 (NP_060518.1, 1 a.a. ~ 148 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAVASDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI |
| Protein accession: | NP_060518.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of MAGOHB expression in transfected 293T cell line (H00055110-T02) by MAGOHB MaxPab polyclonal antibody. Lane 1: FLJ10292 transfected lysate(16.28 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,IF,WB-Tr |
| Shipping condition: | Dry Ice |