TAPBPL monoclonal antibody (M02), clone 6E3 View larger

TAPBPL monoclonal antibody (M02), clone 6E3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TAPBPL monoclonal antibody (M02), clone 6E3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about TAPBPL monoclonal antibody (M02), clone 6E3

Brand: Abnova
Reference: H00055080-M02
Product name: TAPBPL monoclonal antibody (M02), clone 6E3
Product description: Mouse monoclonal antibody raised against a partial recombinant TAPBPL.
Clone: 6E3
Isotype: IgG2a Kappa
Gene id: 55080
Gene name: TAPBPL
Gene alias: FLJ10143|TAPBP-R|TAPBPR
Gene description: TAP binding protein-like
Genbank accession: NM_018009
Immunogen: TAPBPL (NP_060479, 23 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PHPAEGQWRAVDVVLDCFLVKDGAHRGALASSEDRARASLVLKQVPVLDDGSLEDFTDFQGGTLAQDDPPIIFEASVDLVQIPQAEALLHADCSGKEVT
Protein accession: NP_060479
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055080-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055080-M02-1-4-1.jpg
Application image note: TAPBPL monoclonal antibody (M02), clone 6E3 Western Blot analysis of TAPBPL expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TAPBPL monoclonal antibody (M02), clone 6E3 now

Add to cart