GPR172B purified MaxPab mouse polyclonal antibody (B01P) View larger

GPR172B purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GPR172B purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about GPR172B purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00055065-B01P
Product name: GPR172B purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human GPR172B protein.
Gene id: 55065
Gene name: GPR172B
Gene alias: FLJ10060|GPCR|GPCR42|PAR2|RFT1
Gene description: G protein-coupled receptor 172B
Genbank accession: NM_017986.2
Immunogen: GPR172B (NP_060456.2, 1 a.a. ~ 448 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAAPTLGRLVLTHLLVALFGMGSWAAVNGIWVELPVVVKDLPEGWSLPSYLSVVVALGNLGLLVVTLWRRLAPGKGEQVPIQVVQVLSVVGTALLAPLWHHVAPVAGQLHSVAFLTLALVLAMACCTSNVTFLPFLSHLPPPFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPTNGTSGPPLDFPERFPASTFFWALTALLVTSAAAFRGLLLLLPSLPSVTTGGSGPELQLGSPGAEEEEKEEEEALPLQEPPSQAAGTIPGPDPEVHQLFSAHGAFLLGLMAFTSAVTNGVLPSVQSFSCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLVGLSLLGMLFGAYLMALAILSPCPPLVGTTAGVVLVVLSWVLCLCVFSYVKVAASSLLHGGGRPALLAAGVAIQVGSLLGAGAMFPPTSIYHVFQSRKDCVDPCGP
Protein accession: NP_060456.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055065-B01P-13-15-1.jpg
Application image note: Western Blot analysis of GPR172B expression in transfected 293T cell line (H00055065-T01) by GPR172B MaxPab polyclonal antibody.

Lane 1: GPR172B transfected lysate(49.28 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GPR172B purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart