ZCWPW1 purified MaxPab mouse polyclonal antibody (B01P) View larger

ZCWPW1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZCWPW1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about ZCWPW1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00055063-B01P
Product name: ZCWPW1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human ZCWPW1 protein.
Gene id: 55063
Gene name: ZCWPW1
Gene alias: DKFZp434N0510|FLJ10057|ZCW1
Gene description: zinc finger, CW type with PWWP domain 1
Genbank accession: BC002725.1
Immunogen: ZCWPW1 (AAH02725.1, 1 a.a. ~ 477 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGSGLDFAETSCAQPVVSTQSDKEPGITASAADTDNANGEEVPHTQEISVSWEGEAAPEIRTSKLGQPDPAPSKKKSNRLTLSKRKKEAQDEKVEKTQGGHEHRQEDRLKKTVQDHSQIRDQQKGEISGFGQCLVWVQCSFPNCGKWRRLCGNIDPSVLPDNWSCDQNTDVQYNRCDIPEETWTGLESDVAYASYIPGSIIWAKQYGYPWWPGMIESDPDLGEYFLFTSHLDSLPSKYHVTFFGETVSRAWIPVNMLKNFQELSLELSVMKKRRNDCSQKLGVALMMAQEAEQISIQERVNLFGFWSRFNGSNSNGERKDLQLSGLNSPGSCLEKKEKEEELEKEEGEKTDPILPIRKRVKIQTQKTKPRGPKKKFKAPQSKALAASFSEGKEVRTVPKNLGLSACKGACPSSAKEEPRHREPLTQEAGSVPLEDEASSDLDLEQLMEDVGRELGQSGELQHSNSDGEDFPVALFGK
Protein accession: AAH02725.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055063-B01P-13-15-1.jpg
Application image note: Western Blot analysis of ZCWPW1 expression in transfected 293T cell line (H00055063-T01) by ZCWPW1 MaxPab polyclonal antibody.

Lane 1: ZCWPW1 transfected lysate(52.47 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZCWPW1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart