Cart 55 Product Products 18 033,32 € (empty)
-
-
1 x 5-LO...259,07 € -
1 x PRP6...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x NGFR p75...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
18 033,32 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 55 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 18 033,32 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 18 033,32 €
Data sheet of ZCWPW1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about ZCWPW1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00055063-B01P |
| Product name: | ZCWPW1 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human ZCWPW1 protein. |
| Gene id: | 55063 |
| Gene name: | ZCWPW1 |
| Gene alias: | DKFZp434N0510|FLJ10057|ZCW1 |
| Gene description: | zinc finger, CW type with PWWP domain 1 |
| Genbank accession: | BC002725.1 |
| Immunogen: | ZCWPW1 (AAH02725.1, 1 a.a. ~ 477 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGSGLDFAETSCAQPVVSTQSDKEPGITASAADTDNANGEEVPHTQEISVSWEGEAAPEIRTSKLGQPDPAPSKKKSNRLTLSKRKKEAQDEKVEKTQGGHEHRQEDRLKKTVQDHSQIRDQQKGEISGFGQCLVWVQCSFPNCGKWRRLCGNIDPSVLPDNWSCDQNTDVQYNRCDIPEETWTGLESDVAYASYIPGSIIWAKQYGYPWWPGMIESDPDLGEYFLFTSHLDSLPSKYHVTFFGETVSRAWIPVNMLKNFQELSLELSVMKKRRNDCSQKLGVALMMAQEAEQISIQERVNLFGFWSRFNGSNSNGERKDLQLSGLNSPGSCLEKKEKEEELEKEEGEKTDPILPIRKRVKIQTQKTKPRGPKKKFKAPQSKALAASFSEGKEVRTVPKNLGLSACKGACPSSAKEEPRHREPLTQEAGSVPLEDEASSDLDLEQLMEDVGRELGQSGELQHSNSDGEDFPVALFGK |
| Protein accession: | AAH02725.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ZCWPW1 expression in transfected 293T cell line (H00055063-T01) by ZCWPW1 MaxPab polyclonal antibody. Lane 1: ZCWPW1 transfected lysate(52.47 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |