| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Tr |
| Brand: | Abnova |
| Reference: | H00055055-M11 |
| Product name: | ZWILCH monoclonal antibody (M11), clone 1C10 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant ZWILCH. |
| Clone: | 1C10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 55055 |
| Gene name: | ZWILCH |
| Gene alias: | FLJ10036|FLJ16343|KNTC1AP|MGC111034|hZwilch |
| Gene description: | Zwilch, kinetochore associated, homolog (Drosophila) |
| Genbank accession: | BC036900 |
| Immunogen: | ZWILCH (AAH36900, 1 a.a. ~ 477 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAHNPNMTHLKINLPVTALPPLWVRCDSSDPEGTCWLGAELITTNNSITGIVLYVVSCKADKNYSVNLENLKNLHKKRHHLSTVTSKGFAQYELFKSSALDDTITASQTAIALDISWSPVDEILQIPPLSSTATLNIKVESGEPRGPLNHLYRELKFLLVLADGLRTGVTEWLEPLEAKSAVELVQEFLNDLNKLDGFGDSTKKDTEVETLKHDTAAVDRSVKRLFKVRSDLDFAEQLWCKMSSSVISYQDLVKCFTLIIQSLQRGDIQPWLHSGSNSLLSKLIHQSYHGTMDTVSLSGTIPVQMLLEIGLDKLKKDYISFFIGQELASLNHLEYFIAPSVDIQEQVYRVQKLHHILEILVSCMPFIKSQHELLFSLTQICIKYYKQNPLDEQHIFQLPVRPTAVKNLYQSEKPQKWRVEIYSGQKKIKTVWQLSDSSPIDHLNFHKPDFSELTLNGSLEERIFFTNMVTCSQVHFK |
| Protein accession: | AAH36900 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of ZWILCH expression in transfected 293T cell line by ZWILCH monoclonal antibody (M11), clone 1C10. Lane 1: ZWILCH transfected lysate (Predicted MW: 54.2 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Tr |
| Shipping condition: | Dry Ice |