Cart 27 Product Products 8 440,06 € (empty)
No products
To be determined Shipping
8 440,06 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 27 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 8 440,06 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 8 440,06 €
Data sheet of ZWILCH purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr |
More info about ZWILCH purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00055055-D01P |
| Product name: | ZWILCH purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human ZWILCH protein. |
| Gene id: | 55055 |
| Gene name: | ZWILCH |
| Gene alias: | FLJ10036|FLJ16343|KNTC1AP|MGC111034|hZwilch |
| Gene description: | Zwilch, kinetochore associated, homolog (Drosophila) |
| Genbank accession: | BC036900 |
| Immunogen: | ZWILCH (AAH36900.1, 1 a.a. ~ 477 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAHNPNMTHLKINLPVTALPPLWVRCDSSDPEGTCWLGAELITTNNSITGIVLYVVSCKADKNYSVNLENLKNLHKKRHHLSTVTSKGFAQYELFKSSALDDTITASQTAIALDISWSPVDEILQIPPLSSTATLNIKVESGEPRGPLNHLYRELKFLLVLADGLRTGVTEWLEPLEAKSAVELVQEFLNDLNKLDGFGDSTKKDTEVETLKHDTAAVDRSVKRLFKVRSDLDFAEQLWCKMSSSVISYQDLVKCFTLIIQSLQRGDIQPWLHSGSNSLLSKLIHQSYHGTMDTVSLSGTIPVQMLLEIGLDKLKKDYISFFIGQELASLNHLEYFIAPSVDIQEQVYRVQKLHHILEILVSCMPFIKSQHELLFSLTQICIKYYKQNPLDEQHIFQLPVRPTAVKNLYQSEKPQKWRVEIYSGQKKIKTVWQLSDSSPIDHLNFHKPDFSELTLNGSLEERIFFTNMVTCSQVHFK |
| Protein accession: | AAH36900.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | ZWILCH MaxPab rabbit polyclonal antibody. Western Blot analysis of ZWILCH expression in mouse spleen. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |