ZWILCH MaxPab mouse polyclonal antibody (B01) View larger

ZWILCH MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZWILCH MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about ZWILCH MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00055055-B01
Product name: ZWILCH MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human ZWILCH protein.
Gene id: 55055
Gene name: ZWILCH
Gene alias: FLJ10036|FLJ16343|KNTC1AP|MGC111034|hZwilch
Gene description: Zwilch, kinetochore associated, homolog (Drosophila)
Genbank accession: BC036900
Immunogen: ZWILCH (AAH36900, 1 a.a. ~ 477 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAHNPNMTHLKINLPVTALPPLWVRCDSSDPEGTCWLGAELITTNNSITGIVLYVVSCKADKNYSVNLENLKNLHKKRHHLSTVTSKGFAQYELFKSSALDDTITASQTAIALDISWSPVDEILQIPPLSSTATLNIKVESGEPRGPLNHLYRELKFLLVLADGLRTGVTEWLEPLEAKSAVELVQEFLNDLNKLDGFGDSTKKDTEVETLKHDTAAVDRSVKRLFKVRSDLDFAEQLWCKMSSSVISYQDLVKCFTLIIQSLQRGDIQPWLHSGSNSLLSKLIHQSYHGTMDTVSLSGTIPVQMLLEIGLDKLKKDYISFFIGQELASLNHLEYFIAPSVDIQEQVYRVQKLHHILEILVSCMPFIKSQHELLFSLTQICIKYYKQNPLDEQHIFQLPVRPTAVKNLYQSEKPQKWRVEIYSGQKKIKTVWQLSDSSPIDHLNFHKPDFSELTLNGSLEERIFFTNMVTCSQVHFK
Protein accession: AAH36900
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055055-B01-13-15-1.jpg
Application image note: Western Blot analysis of ZWILCH expression in transfected 293T cell line (H00055055-T01) by ZWILCH MaxPab polyclonal antibody.

Lane 1: ZWILCH transfected lysate(52.47 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZWILCH MaxPab mouse polyclonal antibody (B01) now

Add to cart