Brand: | Abnova |
Reference: | H00055031-M02 |
Product name: | USP47 monoclonal antibody (M02), clone 1E6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant USP47. |
Clone: | 1E6 |
Isotype: | IgG2a Kappa |
Gene id: | 55031 |
Gene name: | USP47 |
Gene alias: | DKFZp686C13257|FLJ20727|TRFP |
Gene description: | ubiquitin specific peptidase 47 |
Genbank accession: | NM_017944 |
Immunogen: | USP47 (NP_060414, 203 a.a. ~ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TEQADLINELYQGKLKDYVRCLECGYEGWRIDTYLDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFLHFPYLLTLQ |
Protein accession: | NP_060414 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to USP47 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |