| Brand: | Abnova |
| Reference: | H00055031-M01 |
| Product name: | USP47 monoclonal antibody (M01), clone 5F9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant USP47. |
| Clone: | 5F9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 55031 |
| Gene name: | USP47 |
| Gene alias: | DKFZp686C13257|FLJ20727|TRFP |
| Gene description: | ubiquitin specific peptidase 47 |
| Genbank accession: | NM_017944 |
| Immunogen: | USP47 (NP_060414, 203 a.a. ~ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TEQADLINELYQGKLKDYVRCLECGYEGWRIDTYLDIPLVIRPYGSSQAFASVEEALHAFIQPEILDGPNQYFCERCKKKCDARKGLRFLHFPYLLTLQ |
| Protein accession: | NP_060414 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to USP47 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | USP47 and C Terminus of Hsp70-Interacting Protein (CHIP) Antagonistically Regulate Katanin-p60-Mediated Axonal Growth.Yang SW, Oh KH, Park E, Chang HM, Park JM, Seong MW, Ka SH, Song WK, Park DE, Baas PW, Jeon YJ, Chung CH J Neurosci. 2013 Jul 31;33(31):12728-38. doi: 10.1523/JNEUROSCI.0698-13.2013. |