View larger

FBXO34 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of FBXO34 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00055030-A01
Product name:	FBXO34 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant FBXO34.
Gene id:	55030
Gene name:	FBXO34
Gene alias:	CGI-301\|DKFZp547C162\|FLJ20725\|Fbx34\|MGC126434\|MGC126435
Gene description:	F-box protein 34
Genbank accession:	NM_017943
Immunogen:	FBXO34 (NP_060413, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	MHLKPYWKLQKKEHPPEVSRETQRTPMNHQKAVNDETCKASHITSSVFPSASLGKASSRKPFGILSPNVLCSMSGKSPVESSLNVKTKKNAPSATIHQGE
Protein accession:	NP_060413
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37.11 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice