Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PHIP monoclonal antibody (M01), clone 4D7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about PHIP monoclonal antibody (M01), clone 4D7
| Brand: | Abnova |
| Reference: | H00055023-M01 |
| Product name: | PHIP monoclonal antibody (M01), clone 4D7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PHIP. |
| Clone: | 4D7 |
| Isotype: | IgG2b Kappa |
| Gene id: | 55023 |
| Gene name: | PHIP |
| Gene alias: | FLJ20705|FLJ45918|MGC90216|WDR11|ndrp |
| Gene description: | pleckstrin homology domain interacting protein |
| Genbank accession: | NM_017934 |
| Immunogen: | PHIP (NP_060404, 1599 a.a. ~ 1705 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TLSKSSAVIEQGDCKNNALVPGTIQVNGHGGQPSKLVKRGPGRKPKVEVNTNSGEIIHKKRGRKPKKLQYAKPEDLEQNNVHPIRDEVLPSSTCNFLSETNNVKEDL |
| Protein accession: | NP_060404 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.51 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to PHIP on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Pleckstrin homology domain-interacting protein (PHIP) as a marker and mediator of melanoma metastasis.De Semir D, Nosrati M, Bezrookove V, Dar AA, Federman S, Bienvenu G, Venna S, Rangel J, Climent J, Meyer Tamguney TM, Thummala S, Tong S, Leong SP, Haqq C, Billings P, Miller JR 3rd, Sagebiel RW, Debs R, Kashani-Sabet M. Proc Natl Acad Sci U S A. 2012 May 1;109(18):7067-72. Epub 2012 Apr 17. |