View larger

PINX1 polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of PINX1 polyclonal antibody (A01)

Brand	Abnova
Product type	Primary antibodies
Reactivity	Human
Host species	Mouse
Applications	WB-Ce,ELISA,WB-Re

More info about PINX1 polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00054984-A01
Product name:	PINX1 polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant PINX1.
Gene id:	54984
Gene name:	PINX1
Gene alias:	FLJ20565\|LPTL\|LPTS\|MGC8850
Gene description:	PIN2-interacting protein 1
Genbank accession:	BC015479
Immunogen:	PINX1 (AAH15479, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEHGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDFNQLLAELNTCHGQETT
Protein accession:	AAH15479
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	PINX1 polyclonal antibody (A01), Lot # 060509JCS1 Western Blot analysis of PINX1 expression in IMR-32 ( Cat # L008V1 ).
Applications:	WB-Ce,ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	The effects of telomere shortening on cancer cells: A network model of proteomic and microRNA analysis.Uziel O, Yosef N, Sharan R, Ruppin E, Kupiec M, Kushnir M, Beery E, Cohen-Diker T, Nordenberg J, Lahav M. Genomics. 2015 Jan;105(1):5-16.

Reviews

Be the first to write your review !

Buy PINX1 polyclonal antibody (A01) now

Add to cart