Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of THG1L monoclonal antibody (M01), clone 4F11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Tr |
More info about THG1L monoclonal antibody (M01), clone 4F11
| Brand: | Abnova |
| Reference: | H00054974-M01 |
| Product name: | THG1L monoclonal antibody (M01), clone 4F11 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant THG1L. |
| Clone: | 4F11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 54974 |
| Gene name: | THG1L |
| Gene alias: | FLJ11601|FLJ20546|ICF45 |
| Gene description: | tRNA-histidine guanylyltransferase 1-like (S. cerevisiae) |
| Genbank accession: | BC001523 |
| Immunogen: | THG1L (AAH01523, 1 a.a. ~ 269 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAKSKFEYVRDFEADDTCLAHCWVVVRLDGRNFHRFAEKHNFAKPNDSRALQLMTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKTNWFKRRASKFMTHVASQFASSYVFYWRDYFEDQPLLYPPGFDGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINYNNELPMYRKGTVLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCDIIGDAFWKEHPEILDEDS |
| Protein accession: | AAH01523 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of THG1L expression in transfected 293T cell line by THG1L monoclonal antibody (M01), clone 4F11. Lane 1: THG1L transfected lysate (Predicted MW: 34.8 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Tr |
| Shipping condition: | Dry Ice |