Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,WB-Tr |
Brand: | Abnova |
Reference: | H00054974-B01P |
Product name: | ICF45 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human ICF45 protein. |
Gene id: | 54974 |
Gene name: | THG1L |
Gene alias: | FLJ11601|FLJ20546|ICF45 |
Gene description: | tRNA-histidine guanylyltransferase 1-like (S. cerevisiae) |
Genbank accession: | BC023521.2 |
Immunogen: | ICF45 (AAH23521.1, 1 a.a. ~ 298 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MWGACKVKVHDSLATISITLRRYLRLGATMAKSKFEYVRDFEADDTCLAHCWVVVRLDGRNFHRFAEKHNFAKPNDSRALQLMTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKTNWFKRRASKFMTHVASQFASSYVFYWRDYFEDQPLLYPPGFDGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINYNNEPPMYRKGTVLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCDIIGDAFWKEHPEILDEDS |
Protein accession: | AAH23521.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of THG1L expression in transfected 293T cell line (H00054974-T01) by THG1L MaxPab polyclonal antibody. Lane1:ICF45 transfected lysate(32.78 KDa). Lane2:Non-transfected lysate. |
Applications: | WB-Ce,WB-Tr |
Shipping condition: | Dry Ice |