Brand: | Abnova |
Reference: | H00054974-A01 |
Product name: | ICF45 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant ICF45. |
Gene id: | 54974 |
Gene name: | THG1L |
Gene alias: | FLJ11601|FLJ20546|ICF45 |
Gene description: | tRNA-histidine guanylyltransferase 1-like (S. cerevisiae) |
Genbank accession: | BC001523 |
Immunogen: | ICF45 (AAH01523, 1 a.a. ~ 269 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MAKSKFEYVRDFEADDTCLAHCWVVVRLDGRNFHRFAEKHNFAKPNDSRALQLMTKCAQTVMEELEDIVIAYGQSDEYSFVFKRKTNWFKRRASKFMTHVASQFASSYVFYWRDYFEDQPLLYPPGFDGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINYNNELPMYRKGTVLIWQKVDEVMTKEIKLPTEMEGKKMAVTRTRTKPVPLHCDIIGDAFWKEHPEILDEDS |
Protein accession: | AAH01523 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (55.33 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |