| Brand: | Abnova |
| Reference: | H00054963-M01 |
| Product name: | UCKL1 monoclonal antibody (M01), clone 8D4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant UCKL1. |
| Clone: | 8D4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 54963 |
| Gene name: | UCKL1 |
| Gene alias: | UCK1-LIKE|UCK1L|URKL1 |
| Gene description: | uridine-cytidine kinase 1-like 1 |
| Genbank accession: | NM_017859 |
| Immunogen: | UCKL1 (NP_060329, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EERELSVRAALASAHQCHPLPRTLSVLKSTPQVRGMHTIIRDKETSRDEFIFYSKRLMRLLIEHALSFLPFQDCVVQTPQGQDYAGKCYAGKQITGVSIL |
| Protein accession: | NP_060329 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to UCKL1 on NIH/3T3 cell. [antibody concentration 10 ug/ml] |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |