TIPIN purified MaxPab mouse polyclonal antibody (B01P) View larger

TIPIN purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TIPIN purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about TIPIN purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00054962-B01P
Product name: TIPIN purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human FLJ20516 protein.
Gene id: 54962
Gene name: TIPIN
Gene alias: FLJ20516
Gene description: TIMELESS interacting protein
Genbank accession: BC000870.1
Immunogen: FLJ20516 (AAH00870.1, 1 a.a. ~ 301 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLEPQENGVIDLPDYEHVEDETFPPFPPPASPERQDGEGTEPDEESGNGAPVPVPPKRTVKRNIPKLDAQRLISERGLPALRHVFDKAKFKGKGHEAEDLKMLIRHMEHWAHRLFPKLQFEDFIDRVEYLGSKKEVQTCLKRIRLDLPILHEDFVSNNDEVAENNEHDVTSTELDPFLTNLSESEMFASELSRSLTEEQQQRIERNKQLALERRQAKLLSNSQTLGNDMLMNTPRAHTVEEVNTDEDQKEESNGLNEDILDNPCNDAIANTLNEEETLLDQSFKNVQQQLDATSRNITEAR
Protein accession: AAH00870.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00054962-B01P-13-15-1.jpg
Application image note: Western Blot analysis of TIPIN expression in transfected 293T cell line (H00054962-T01) by TIPIN MaxPab polyclonal antibody.

Lane 1: TIPIN transfected lysate(33.11 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TIPIN purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart