Brand: | Abnova |
Reference: | H00054941-M03 |
Product name: | RNF125 monoclonal antibody (M03), clone 1D3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RNF125. |
Clone: | 1D3 |
Isotype: | IgG1 Kappa |
Gene id: | 54941 |
Gene name: | RNF125 |
Gene alias: | FLJ20456|MGC21737|TRAC1 |
Gene description: | ring finger protein 125 |
Genbank accession: | NM_017831 |
Immunogen: | RNF125 (NP_060301, 143 a.a. ~ 231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNHSNT |
Protein accession: | NP_060301 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged RNF125 is 0.1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |