RNF125 monoclonal antibody (M01), clone 1A5 View larger

RNF125 monoclonal antibody (M01), clone 1A5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNF125 monoclonal antibody (M01), clone 1A5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about RNF125 monoclonal antibody (M01), clone 1A5

Brand: Abnova
Reference: H00054941-M01
Product name: RNF125 monoclonal antibody (M01), clone 1A5
Product description: Mouse monoclonal antibody raised against a partial recombinant RNF125.
Clone: 1A5
Isotype: IgG1 Kappa
Gene id: 54941
Gene name: RNF125
Gene alias: FLJ20456|MGC21737|TRAC1
Gene description: ring finger protein 125
Genbank accession: NM_017831
Immunogen: RNF125 (NP_060301, 143 a.a. ~ 231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FCQRELYEDSLLDHCITHHRSERRPVFCPLCRLIPDENPSSFSGSLIRHLQVSHTLFYDDFIDFNIIEEALIRRVLDRSLLEYVNHSNT
Protein accession: NP_060301
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00054941-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00054941-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged RNF125 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RNF125 monoclonal antibody (M01), clone 1A5 now

Add to cart