| Brand: | Abnova |
| Reference: | H00054937-M04 |
| Product name: | TEB1 monoclonal antibody (M04), clone 1E1 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant TEB1. |
| Clone: | 1E1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 54937 |
| Gene name: | SOHLH2 |
| Gene alias: | FLJ20449|TEB1|bA121N13.2 |
| Gene description: | spermatogenesis and oogenesis specific basic helix-loop-helix 2 |
| Genbank accession: | BC025383 |
| Immunogen: | TEB1 (AAH25383, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MASSIICQEHCQISGQAKIDILLVGDVTVGYLADTVQKLFANIAEVTITISDTKEAAALLDDCIFNMVLLKVPSSLSAEELEAIKLIRFGKKKNTHSLFVFIIPENFKGCISGHGMDIALTEPLTMEKMSNVVKYWTTCPSNTVKTENATGPEELGLPLQRSYSEHLGYFPTDLFACSESLRNGNGLELNASLSEFEKNKKISLLHSSKEKLRRLYRKHSSFCFW |
| Protein accession: | AAH25383 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of SOHLH2 transfected lysate using anti-SOHLH2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SOHLH2 MaxPab rabbit polyclonal antibody. |
| Applications: | S-ELISA,ELISA,IP |
| Shipping condition: | Dry Ice |