No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Brand: | Abnova |
| Reference: | H00054926-M01 |
| Product name: | UBE2R2 monoclonal antibody (M01), clone 5E7 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant UBE2R2. |
| Clone: | 5E7 |
| Isotype: | IgG2b kappa |
| Gene id: | 54926 |
| Gene name: | UBE2R2 |
| Gene alias: | CDC34B|FLJ20419|MGC10481|UBC3B |
| Gene description: | ubiquitin-conjugating enzyme E2R 2 |
| Genbank accession: | BC047584 |
| Immunogen: | UBE2R2 (AAH47584, 1 a.a. ~ 238 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAQQQMTSSQKALMLELKSLQEEPVEGFRITLVDESDLYNWEVAIFGPPNTLYEGGYFKAHIKFPIDYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMFRKWRDSKGKDKEYAEIIRKQVSATKAEAEKDGVKVPTTLAEYCIKTKVPSNDNSSDLLYDDLYDDDIDDEDEEEEDADCYDDDDSGNEES |
| Protein accession: | AAH47584 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (51.92 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | UBE2R2 monoclonal antibody (M01), clone 5E7 Western Blot analysis of UBE2R2 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |