Brand: | Abnova |
Reference: | H00054925-M09A |
Product name: | ZNF434 monoclonal antibody (M09A), clone 3D8 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant ZNF434. |
Clone: | 3D8 |
Isotype: | IgM Kappa |
Gene id: | 54925 |
Gene name: | ZNF434 |
Gene alias: | FLJ20417|FLJ31901|MGC4179 |
Gene description: | zinc finger protein 434 |
Genbank accession: | BC002859 |
Immunogen: | ZNF434 (AAH02859, 1 a.a. ~ 256 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAAVKSTEAHPSSNKDPTQGQKSALQGNSPDSGASRQRFRQFCYQEVTGPHEAFSKLWELCCQWLRPKTHSKEEILELLVLEQFLTILPEEIQTWVREQHPENGEEAVALVEDVQRAPGQQVLDSEKDLKVLMKEMAPLGATRESLRSQWKQEVQPEEPTFKGSQSSHQRPGEQSEAWLAPQAPRNLPQNTGLHDQETGAVVWTAGSQGPAMRDNRAVSLCQQEWMCPGPAQRALYRGATQRKDSHVSLATGALGL |
Protein accession: | AAH02859 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (53.9 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |