Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of BCOR polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about BCOR polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00054880-A01 |
| Product name: | BCOR polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant BCOR. |
| Gene id: | 54880 |
| Gene name: | BCOR |
| Gene alias: | ANOP2|FLJ20285|FLJ38041|KIAA1575|MAA2|MCOPS2|MGC131961|MGC71031 |
| Gene description: | BCL6 co-repressor |
| Genbank accession: | NM_017745 |
| Immunogen: | BCOR (NP_060215, 1361 a.a. ~ 1460 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | RRFRKRPEPSSDYDLSPAKQEPKPFDRLQQLLPASQSTQLPCSSSPQETTQSRPMPPEARRLIVNKNAGETLLQRAARLGYEEVVLYCLENKICDVNHRD |
| Protein accession: | NP_060215 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of BCOR expression in transfected 293T cell line by BCOR polyclonal antibody (A01). Lane1:BCOR transfected lysate (Predicted MW: 36.74 KDa). Lane2:Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Proteomics Analysis of Ring1B/Rnf2 Interactors Identifies a Novel Complex with the Fbxl10/Jhdm1B Histone Demethylase and the Bcl6 Interacting Corepressor.Sanchez C, Sanchez I, Demmers JA, Rodriguez P, Strouboulis J, Vidal M. Mol Cell Proteomics. 2007 May;6(5):820-34. Epub 2007 Feb 11. |