DPP8 monoclonal antibody (M01), clone 1B10 View larger

DPP8 monoclonal antibody (M01), clone 1B10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DPP8 monoclonal antibody (M01), clone 1B10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about DPP8 monoclonal antibody (M01), clone 1B10

Brand: Abnova
Reference: H00054878-M01
Product name: DPP8 monoclonal antibody (M01), clone 1B10
Product description: Mouse monoclonal antibody raised against a partial recombinant DPP8.
Clone: 1B10
Isotype: IgG2a Kappa
Gene id: 54878
Gene name: DPP8
Gene alias: DP8|DPRP1|FLJ14920|FLJ20283|MGC26191|MSTP141
Gene description: dipeptidyl-peptidase 8
Genbank accession: NM_197961
Immunogen: DPP8 (NP_932065.1, 161 a.a. ~ 244 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IGTVGIASYDYHQGSGTFLFQAGSGIYHVKDGGPQGFTQQPLRPNLVETSCPNIRMDPKLCPADPDWIAFIHSNDIWISNIVTR
Protein accession: NP_932065.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00054878-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged DPP8 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy DPP8 monoclonal antibody (M01), clone 1B10 now

Add to cart