Cart 7 Product Products 2 998,44 € (empty)
No products
To be determined Shipping
2 998,44 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 7 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 998,44 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 998,44 €
Data sheet of PAQR5 monoclonal antibody (M01), clone 1F4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about PAQR5 monoclonal antibody (M01), clone 1F4
| Brand: | Abnova |
| Reference: | H00054852-M01 |
| Product name: | PAQR5 monoclonal antibody (M01), clone 1F4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PAQR5. |
| Clone: | 1F4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 54852 |
| Gene name: | PAQR5 |
| Gene alias: | FLJ20190|MPRG |
| Gene description: | progestin and adipoQ receptor family member V |
| Genbank accession: | NM_017705 |
| Immunogen: | PAQR5 (NP_060175, 1 a.a. ~ 51 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ESGVAAAREECLVSGLPVLSPRPVHWTPETLGTQDTIGETGHFTKDLTGM* |
| Protein accession: | NP_060175 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.61 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |