Cart 6 Product Products 3 394,25 € (empty)
No products
To be determined Shipping
3 394,25 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 6 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 3 394,25 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 3 394,25 €
Data sheet of APTX monoclonal antibody (M02), clone 2H6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about APTX monoclonal antibody (M02), clone 2H6
| Brand: | Abnova |
| Reference: | H00054840-M02 |
| Product name: | APTX monoclonal antibody (M02), clone 2H6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant APTX. |
| Clone: | 2H6 |
| Isotype: | IgG2a Lambda |
| Gene id: | 54840 |
| Gene name: | APTX |
| Gene alias: | AOA|AOA1|AXA1|EAOH|EOAHA|FHA-HIT|FLJ20157|MGC1072 |
| Gene description: | aprataxin |
| Genbank accession: | NM_175071 |
| Immunogen: | APTX (NP_778241.1, 69 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KLRFRLGYHAIPSMSHVHLHVISQDFDSPCLKNKKHWNSFNTEYFLESQAVIEMVQEAGRVTVRDGMPELLKLPLRCHECQQLLPSIPQLKEHLRKHW |
| Protein accession: | NP_778241.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged APTX is 3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |