No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00054836-B01P |
Product name: | BSPRY purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human BSPRY protein. |
Gene id: | 54836 |
Gene name: | BSPRY |
Gene alias: | FLJ20150 |
Gene description: | B-box and SPRY domain containing |
Genbank accession: | BC001477 |
Immunogen: | BSPRY (AAH01477.1, 1 a.a. ~ 193 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MSAEGAEPGPGSGSGPGPGPLCPEHGQALSWFCGSERRPVCAACAGLGGRCRGHRIRRAEERAEELRNKIVDQCERLQLQSAAITKYVADVLPGKNQRAVSMASAARELVIQRLSLVRSLCESEEQRLLEQVHGEEERAHQSILTQRVHWAEALQKLDTIRTGLVGMLTHLDDLQLIQKEQEIFERHRGHTDR |
Protein accession: | AAH01477.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of BSPRY expression in transfected 293T cell line (H00054836-T01) by BSPRY MaxPab polyclonal antibody. Lane 1: BSPRY transfected lysate(21.23 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | A proteomic approach to study parathyroid glands.Giusti L, Cetani F, Ciregia F, Da Valle Y, Donadio E, Giannaccini G, Banti C, Pardi E, Saponaro F, Basolo F, Berti P, Miccoli P, Pinchera A, Marcocci C, Lucacchini A. Mol Biosyst. 2011 Mar;7(3):687-99. Epub 2010 Dec 21. |