No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00054815-M01 |
Product name: | GATAD2A monoclonal antibody (M01), clone 3F3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GATAD2A. |
Clone: | 3F3 |
Isotype: | IgG2a Kappa |
Gene id: | 54815 |
Gene name: | GATAD2A |
Gene alias: | FLJ20085|FLJ21017|p66alpha |
Gene description: | GATA zinc finger domain containing 2A |
Genbank accession: | NM_017660 |
Immunogen: | GATAD2A (NP_060130, 26 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QIQKEATAQKPTGSVGSTVTTPPPLVRGTQNIPAGKPSLQTSSARMPGSVIPPPLVRGGQQASSKLGPQASSQVVMPPLVRGAQQIHSIRQHSSTGPPPLLLAPRASVP |
Protein accession: | NP_060130 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of GATAD2A expression in transfected 293T cell line by GATAD2A monoclonal antibody (M01), clone 3F3. Lane 1: GATAD2A transfected lysate (Predicted MW: 52.5 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |