| Brand: | Abnova |
| Reference: | H00054739-M05 |
| Product name: | XAF1 monoclonal antibody (M05), clone 3E5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant XAF1. |
| Clone: | 3E5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 54739 |
| Gene name: | XAF1 |
| Gene alias: | BIRC4BP|HSXIAPAF1|XIAPAF1 |
| Gene description: | XIAP associated factor 1 |
| Genbank accession: | NM_017523 |
| Immunogen: | XAF1 (NP_059993.2, 202 a.a. ~ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QTSTMEKDVRPKTRSINRFPLHSESSSKKAPRSKNKTLDPLLMSEPKPRTSSPRGDKAAYDILRRCSQCGILLPLPILNQHQEKCRWLASSKGKQVRNFS |
| Protein accession: | NP_059993.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | XAF1 monoclonal antibody (M05), clone 3E5. Western Blot analysis of XAF1 expression in Hela S3 NE(Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA |
| Shipping condition: | Dry Ice |