Cart 10 Product Products 3 711,45 € (empty)
No products
To be determined Shipping
3 711,45 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 10 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 3 711,45 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 3 711,45 €
Data sheet of SLC6A20 monoclonal antibody (M02), clone 3G6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about SLC6A20 monoclonal antibody (M02), clone 3G6
| Brand: | Abnova |
| Reference: | H00054716-M02 |
| Product name: | SLC6A20 monoclonal antibody (M02), clone 3G6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC6A20. |
| Clone: | 3G6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 54716 |
| Gene name: | SLC6A20 |
| Gene alias: | MGC161475|SIT1|XT3|Xtrp3 |
| Gene description: | solute carrier family 6 (proline IMINO transporter), member 20 |
| Genbank accession: | NM_020208 |
| Immunogen: | SLC6A20 (NP_064593, 301 a.a. ~ 369 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSEMFPQIKNCSLESELDTAVQ |
| Protein accession: | NP_064593 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.33 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SLC6A20 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |