Brand: | Abnova |
Reference: | H00054716-M02 |
Product name: | SLC6A20 monoclonal antibody (M02), clone 3G6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC6A20. |
Clone: | 3G6 |
Isotype: | IgG1 Kappa |
Gene id: | 54716 |
Gene name: | SLC6A20 |
Gene alias: | MGC161475|SIT1|XT3|Xtrp3 |
Gene description: | solute carrier family 6 (proline IMINO transporter), member 20 |
Genbank accession: | NM_020208 |
Immunogen: | SLC6A20 (NP_064593, 301 a.a. ~ 369 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSEMFPQIKNCSLESELDTAVQ |
Protein accession: | NP_064593 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.33 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged SLC6A20 is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |