No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00054700-B01P |
Product name: | RRN3 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human RRN3 protein. |
Gene id: | 54700 |
Gene name: | RRN3 |
Gene alias: | DKFZp566E104|MGC104238|TIFIA |
Gene description: | RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae) |
Genbank accession: | ENST00000219758 |
Immunogen: | RRN3 (ENSP00000219758, 1 a.a. ~ 106 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MRALENDFFNSPPRKTVRFGGTVTEVLLKYKKGETNDFELLKNQLLDPDIKDDQIINWLLEFRSSVMYLTKDFEQLISIILRLPWLNRSQTVVEEYLAFLGNLVSA |
Protein accession: | ENSP00000219758 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of RRN3 expression in transfected 293T cell line (H00054700-T01) by RRN3 MaxPab polyclonal antibody. Lane 1: RRN3 transfected lysate(11.66 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |