Cart 40 Product Products 17 647,00 € (empty)
No products
To be determined Shipping
17 647,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 40 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 17 647,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 17 647,00 €
Data sheet of RRN3 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about RRN3 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00054700-A01 |
| Product name: | RRN3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant RRN3. |
| Gene id: | 54700 |
| Gene name: | RRN3 |
| Gene alias: | DKFZp566E104|MGC104238|TIFIA |
| Gene description: | RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae) |
| Genbank accession: | NM_018427 |
| Immunogen: | RRN3 (NP_060897, 525 a.a. ~ 631 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | CYTIIERNNRQMLPVIRSTAGGDSVQICTNPLDTFFPFDPCVLKRSKKFIDPIYQVWEDMSAEELQEFKKPMKKDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHF |
| Protein accession: | NP_060897 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.88 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | RRN3 polyclonal antibody (A01), Lot # 051012JC01 Western Blot analysis of RRN3 expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |