| Brand: | Abnova |
| Reference: | H00054663-D01P |
| Product name: | WDR74 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human WDR74 protein. |
| Gene id: | 54663 |
| Gene name: | WDR74 |
| Gene alias: | FLJ10439|FLJ21730 |
| Gene description: | WD repeat domain 74 |
| Genbank accession: | BC006351.1 |
| Immunogen: | WDR74 (AAH06351.1, 1 a.a. ~ 366 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAAAAARWNHVWVGTETGILKGVNLQRKQAANFTAGGQPRREEAVSALCWGTGGETQMLVGCADRTVKHFSTEDGIFQGQRHCPGGEGMFRGLAQADGTLITCVDSGILRVWHDKDKDTSSDPLLELRVGPGVCRMRQDPAHPHVVATGGKENALKIWDLQGSEEPVFRAKNVRNDWLDLRVPIWDQDIQFLPGSQKLVTCTGYHQVRVYDPASPQRRPVLETTYGEYPLTAMTLTPGGNSVIVGNTHGQLAEIDLRQGRLLGCLKGLAGSVRGLQCHPSKPLLASCGLDRVLRIHRIQNPRGLEHKDEPQEPQEPNKVPLEDTETDELWASLEAAAKRKLSGLEQPQGALQTRRRKKKRPGSTSP |
| Protein accession: | AAH06351.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of WDR74 expression in transfected 293T cell line () by WDR74 MaxPab polyclonal antibody.
Lane 1: WDR74 transfected lysate(40.37 KDa). Lane 2: Non-transfected lysate.
|
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |