| Brand: | Abnova |
| Reference: | H00054626-M09 |
| Product name: | HES2 monoclonal antibody (M09), clone 3B3 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant HES2. |
| Clone: | 3B3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 54626 |
| Gene name: | HES2 |
| Gene alias: | bHLHb40 |
| Gene description: | hairy and enhancer of split 2 (Drosophila) |
| Genbank accession: | NM_019089 |
| Immunogen: | HES2 (NP_061962, 41 a.a. ~ 114 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LPLLGRENSNCSKLEKADVLEMTVRFLQELPASSWPTAAPLPCDSYREGYSACVARLARVLPACRVLEPAVSAR |
| Protein accession: | NP_061962 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.14 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |