HES2 monoclonal antibody (M07), clone 3C2 View larger

HES2 monoclonal antibody (M07), clone 3C2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HES2 monoclonal antibody (M07), clone 3C2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about HES2 monoclonal antibody (M07), clone 3C2

Brand: Abnova
Reference: H00054626-M07
Product name: HES2 monoclonal antibody (M07), clone 3C2
Product description: Mouse monoclonal antibody raised against a full length recombinant HES2.
Clone: 3C2
Isotype: IgG2a Kappa
Gene id: 54626
Gene name: HES2
Gene alias: bHLHb40
Gene description: hairy and enhancer of split 2 (Drosophila)
Genbank accession: NM_019089
Immunogen: HES2 (NP_061962, 41 a.a. ~ 114 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LPLLGRENSNCSKLEKADVLEMTVRFLQELPASSWPTAAPLPCDSYREGYSACVARLARVLPACRVLEPAVSAR
Protein accession: NP_061962
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00054626-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.14 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HES2 monoclonal antibody (M07), clone 3C2 now

Add to cart