| Brand: | Abnova |
| Reference: | H00054620-M03 |
| Product name: | FBXL19 monoclonal antibody (M03), clone 3C5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FBXL19. |
| Clone: | 3C5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 54620 |
| Gene name: | FBXL19 |
| Gene alias: | DKFZp434K0410|Fbl19|JHDM1C|MGC50505 |
| Gene description: | F-box and leucine-rich repeat protein 19 |
| Genbank accession: | NM_019085 |
| Immunogen: | FBXL19 (NP_061958.1, 365 a.a. ~ 472 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RLLDLRWIEDVKDSQLRELLLPPPDTKPGQTESRGRLQGVAELRLAGLELTDASLRLLLRHAPQLSALDLSHCAHVGDPSVHLLTAPTSPLRETLVHLNLAGCHRLTD |
| Protein accession: | NP_061958.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged FBXL19 is 3 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |