No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00054606-M03 |
Product name: | DDX56 monoclonal antibody (M03), clone 6B9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DDX56. |
Clone: | 6B9 |
Isotype: | IgG1 Kappa |
Gene id: | 54606 |
Gene name: | DDX56 |
Gene alias: | DDX21|DDX26|NOH61 |
Gene description: | DEAD (Asp-Glu-Ala-Asp) box polypeptide 56 |
Genbank accession: | NM_019082 |
Immunogen: | DDX56 (NP_061955, 450 a.a. ~ 547 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IKEELLHSEKLKTYFEDNPRDLQLLRHDLPLHPAVVKPHLGHVPDYLVPPALRGLVRPHKKRKKLSSSCRKAKRAKSQNPLRSFKHKGKKFRPTAKPS |
Protein accession: | NP_061955 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | DDX56 monoclonal antibody (M03), clone 6B9. Western Blot analysis of DDX56 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Quantitative Proteomics and Dynamic Imaging of the Nucleolus Reveal Distinct Responses to UV and Ionizing Radiation.Moore HM, Bai B, Boisvert FM, Latonen L, Rantanen V, Simpson JC, Pepperkok R, Lamond AI, Laiho M. Mol Cell Proteomics. 2011 Oct;10(10):M111.009241. Epub 2011 Jul 21. |