Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of UGT1A9 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about UGT1A9 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00054600-A01 |
| Product name: | UGT1A9 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant UGT1A9. |
| Gene id: | 54600 |
| Gene name: | UGT1A9 |
| Gene alias: | HLUGP4|LUGP4|UDPGT|UGT1AI |
| Gene description: | UDP glucuronosyltransferase 1 family, polypeptide A9 |
| Genbank accession: | NM_021027 |
| Immunogen: | UGT1A9 (NP_066307, 27 a.a. ~ 136 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | KLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMPEVSWQLGRSLNCTVKTYSTSYTLEDLDREFKAFAHAQWKAQVRSIYSLLMGSYNDIFDLFFSNCRSLFKDKKLVEY |
| Protein accession: | NP_066307 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Preparation of a Specific Monoclonal Antibody against Human UDP-Glucuronosyltransferase (UGT) 1A9 and Evaluation of UGT1A9 Protein Levels in Human Tissues.Oda S, Nakajima M, Hatakeyama M, Fukami T, Yokoi T. Drug Metab Dispos. 2012 Aug;40(8):1620-7. Epub 2012 May 22. |