| Brand: | Abnova |
| Reference: | H00054583-A01 |
| Product name: | EGLN1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant EGLN1. |
| Gene id: | 54583 |
| Gene name: | EGLN1 |
| Gene alias: | C1orf12|DKFZp761F179|ECYT3|HIFPH2|HPH2|PHD2|SM-20|SM20|ZMYND6 |
| Gene description: | egl nine homolog 1 (C. elegans) |
| Genbank accession: | NM_022051 |
| Immunogen: | EGLN1 (NP_071334, 272 a.a. ~ 355 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | LMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFAD |
| Protein accession: | NP_071334 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.35 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Melanoma Antigen-11 Inhibits the Hypoxia-Inducible Factor Prolyl Hydroxylase 2 and Activates Hypoxic Response.Aprelikova O, Pandolfi S, Tackett S, Ferreira M, Salnikow K, Ward Y, Risinger JI, Barrett JC, Niederhuber J. Cancer Res. 2009 Jan 15;69(2):616-24. |