| Brand: | Abnova |
| Reference: | H00054578-M03 |
| Product name: | UGT1A6 monoclonal antibody (M03), clone 4A10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant UGT1A6. |
| Clone: | 4A10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 54578 |
| Gene name: | UGT1A6 |
| Gene alias: | GNT1|HLUGP|HLUGP1|MGC29860|UDPGT|UGT1|UGT1A6S|UGT1F |
| Gene description: | UDP glucuronosyltransferase 1 family, polypeptide A6 |
| Genbank accession: | NM_001072 |
| Immunogen: | UGT1A6 (NP_001063, 44 a.a. ~ 143 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DIVEVLSDRGHEIVVVVPEVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIGLYFINCQSLLQDRDTLNFFKESK |
| Protein accession: | NP_001063 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged UGT1A6 is 0.1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |