ING3 monoclonal antibody (M13), clone 2E21 View larger

ING3 monoclonal antibody (M13), clone 2E21

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ING3 monoclonal antibody (M13), clone 2E21

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ING3 monoclonal antibody (M13), clone 2E21

Brand: Abnova
Reference: H00054556-M13
Product name: ING3 monoclonal antibody (M13), clone 2E21
Product description: Mouse monoclonal antibody raised against a partial recombinant ING3.
Clone: 2E21
Isotype: IgG2a Kappa
Gene id: 54556
Gene name: ING3
Gene alias: Eaf4|FLJ20089|ING2|p47ING3
Gene description: inhibitor of growth family, member 3
Genbank accession: NM_198267
Immunogen: ING3 (NP_938008, 1 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLQHF
Protein accession: NP_938008
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00054556-M13-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.86 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ING3 monoclonal antibody (M13), clone 2E21 now

Add to cart