No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00054545-A01 |
Product name: | MTMR12 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant MTMR12. |
Gene id: | 54545 |
Gene name: | MTMR12 |
Gene alias: | 3-PAP|PIP3AP |
Gene description: | myotubularin related protein 12 |
Genbank accession: | NM_019061 |
Immunogen: | MTMR12 (NP_061934, 648 a.a. ~ 747 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | PEAQILGGGQVATLSKLLEMMEEVQSLQEKIDERHHSQQAPQAEAPCLLRNSARLSSLFPFALLQRHSSKPVLPTSGWKALGDEDDLAKREDEFVDLGDV |
Protein accession: | NP_061934 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |