Cart 14 Product Products 4 411,34 € (empty)
No products
To be determined Shipping
4 411,34 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 14 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 4 411,34 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 4 411,34 €
Data sheet of NDUFB11 monoclonal antibody (M08), clone 4B2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about NDUFB11 monoclonal antibody (M08), clone 4B2
| Brand: | Abnova |
| Reference: | H00054539-M08 |
| Product name: | NDUFB11 monoclonal antibody (M08), clone 4B2 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant NDUFB11. |
| Clone: | 4B2 |
| Isotype: | IgG2b Kappa |
| Gene id: | 54539 |
| Gene name: | NDUFB11 |
| Gene alias: | ESSS|FLJ20494|MGC111182|NP17.3|Np15|P17.3 |
| Gene description: | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 11, 17.3kDa |
| Genbank accession: | BC010665 |
| Immunogen: | NDUFB11 (AAH10665, 1 a.a. ~ 153 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAGLFGLSARRLLAAAATRGLPAARVRWESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRLVFFFGVSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQLPEDE |
| Protein accession: | AAH10665 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (42.57 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | NDUFB11 monoclonal antibody (M08), clone 4B2 Western Blot analysis of NDUFB11 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |