| Brand: | Abnova |
| Reference: | H00054514-M06 |
| Product name: | DDX4 monoclonal antibody (M06), clone 3D5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DDX4. |
| Clone: | 3D5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 54514 |
| Gene name: | DDX4 |
| Gene alias: | MGC111074|VASA |
| Gene description: | DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 |
| Genbank accession: | NM_019039 |
| Immunogen: | DDX4 (NP_061912.1, 625 a.a. ~ 724 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VHRIGRTGRCGNTGRAISFFDLESDNHLAQPLVKVLTDAQQDVPAWLEEIAFSTYIPGFSGSTRGNVFASVDTRKGKSTLNTAGFSSSQAPNPVDDESWD |
| Protein accession: | NP_061912.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged DDX4 is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |