DDX4 monoclonal antibody (M06), clone 3D5 View larger

DDX4 monoclonal antibody (M06), clone 3D5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DDX4 monoclonal antibody (M06), clone 3D5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about DDX4 monoclonal antibody (M06), clone 3D5

Brand: Abnova
Reference: H00054514-M06
Product name: DDX4 monoclonal antibody (M06), clone 3D5
Product description: Mouse monoclonal antibody raised against a partial recombinant DDX4.
Clone: 3D5
Isotype: IgG2a Kappa
Gene id: 54514
Gene name: DDX4
Gene alias: MGC111074|VASA
Gene description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 4
Genbank accession: NM_019039
Immunogen: DDX4 (NP_061912.1, 625 a.a. ~ 724 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VHRIGRTGRCGNTGRAISFFDLESDNHLAQPLVKVLTDAQQDVPAWLEEIAFSTYIPGFSGSTRGNVFASVDTRKGKSTLNTAGFSSSQAPNPVDDESWD
Protein accession: NP_061912.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00054514-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00054514-M06-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged DDX4 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DDX4 monoclonal antibody (M06), clone 3D5 now

Add to cart