| Brand: | Abnova |
| Reference: | H00054455-M02 |
| Product name: | FBXO42 monoclonal antibody (M02), clone 2F10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FBXO42. |
| Clone: | 2F10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 54455 |
| Gene name: | FBXO42 |
| Gene alias: | Fbx42|KIAA1332 |
| Gene description: | F-box protein 42 |
| Genbank accession: | NM_018994 |
| Immunogen: | FBXO42 (NP_061867, 619 a.a. ~ 717 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RRLGHHPPQSLNVGKPLYQSMNCKPMQMYVLDIKDTKEKGRVKWKVFNSSSVVGPPETSLHTVVQGRGELIIFGGLMDKKQNVKYYPKTNALYFVRAKR |
| Protein accession: | NP_061867 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | FBXO42 monoclonal antibody (M02), clone 2F10 Western Blot analysis of FBXO42 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |